PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn327871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family FAR1
Protein Properties Length: 204aa    MW: 22993 Da    PI: 9.6674
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn327871genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR159.79.1e-1942126290
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                 fY+eYA++vG  +r+ +s++s+r+g+i++r + C    ++++++     + ++r   r gC+a++ vkke ++ w v k++ +HnH+l+
  Achn327871  42 FYDEYATRVGLVTRVLSSRRSERDGSIISRGLGCRDGPYSKQSEGV---ALQKRDRRRDGCTAMILVKKE-KSGWAVRKFVRDHNHPLV 126
                 9*********************************887777766555...88999999*************.899*************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.1E-1742126IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MEDGAGIIVA SVGGELSSGE FEGNQEPVEG MLFDTEEAAR AFYDEYATRV GLVTRVLSSR  60
RSERDGSIIS RGLGCRDGPY SKQSEGVALQ KRDRRRDGCT AMILVKKEKS GWAVRKFVRD  120
HNHPLVVSLP NRRTNLDEKD RKIQELTAEL RVKKRLSTAY RDQLLSLMKD VEEHNENLST  180
KAQVVLNKLK ELDAKRKDLS HHR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016478790.12e-93PREDICTED: protein FAR1-RELATED SEQUENCE 2-like
TrEMBLA0A068UVU43e-92A0A068UVU4_COFCA; Uncharacterized protein
STRINGVIT_05s0102g00470.t014e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.13e-54FAR1 family protein